XCL1 (Human) Recombinant Protein
  • XCL1 (Human) Recombinant Protein

XCL1 (Human) Recombinant Protein

Ref: AB-P3536
XCL1 (Human) Recombinant Protein

Información del producto

Human XCL1 (NP_002986, 22 a.a. - 114 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name XCL1
Gene Alias ATAC|LPTN|LTN|SCM-1|SCM-1a|SCM1|SCYC1
Gene Description chemokine (C motif) ligand 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (2 mM DTT, 30% glycerol).
Gene ID 6375

Enviar uma mensagem


XCL1 (Human) Recombinant Protein

XCL1 (Human) Recombinant Protein