View larger
Human XCL1 (NP_002986, 22 a.a. - 114 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P3536
New product
XCL1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | XCL1 |
| Gene Alias | ATAC|LPTN|LTN|SCM-1|SCM-1a|SCM1|SCYC1 |
| Gene Description | chemokine (C motif) ligand 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (2 mM DTT, 30% glycerol). |
| Gene ID | 6375 |
More info
Human XCL1 (NP_002986, 22 a.a. - 114 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.