View larger
Human KIR3DL1 (NP_037421, 361 a.a. - 444 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P3516
New product
KIR3DL1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | KIR3DL1 |
| Gene Alias | CD158E1|KIR|MGC119726|MGC119728|MGC126589|MGC126591|NKAT3|NKB1|NKB1B |
| Gene Description | killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSTSGTIDKLDIEFHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 14% SDS-PAGE |
| Storage Buffer | In 25 mM Tris-HCl buffer, 100 mM NaCl, pH 7.5. |
| Gene ID | 3811 |
More info
Human KIR3DL1 (NP_037421, 361 a.a. - 444 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.