TXN (Human) Recombinant Protein View larger

Human TXN (NP_003320, 1 a.a. - 105 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P3507

New product

TXN (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name TXN
Gene Alias DKFZp686B1993|MGC61975|TRX|TRX1
Gene Description thioredoxin
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In PBS, pH 7.4.
Gene ID 7295

More info

Human TXN (NP_003320, 1 a.a. - 105 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human TXN (NP_003320, 1 a.a. - 105 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human TXN (NP_003320, 1 a.a. - 105 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.