PRDX4 (Human) Recombinant Protein
  • PRDX4 (Human) Recombinant Protein

PRDX4 (Human) Recombinant Protein

Ref: AB-P3505
PRDX4 (Human) Recombinant Protein

Información del producto

Human PRDX4 (NP_006397, 38 a.a. - 271 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PRDX4
Gene Alias AOE37-2|PRX-4
Gene Description peroxiredoxin 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Gene ID 10549

Enviar uma mensagem


PRDX4 (Human) Recombinant Protein

PRDX4 (Human) Recombinant Protein