LDHA (Human) Recombinant Protein View larger

Human LDHA (NP_005557, 1 a.a. - 332 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P3499

New product

LDHA (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name LDHA
Gene Alias LDH-M|LDH1|PIG19
Gene Description lactate dehydrogenase A
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVV
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol).
Gene ID 3939

More info

Human LDHA (NP_005557, 1 a.a. - 332 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human LDHA (NP_005557, 1 a.a. - 332 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human LDHA (NP_005557, 1 a.a. - 332 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.