AKR7A2 (Human) Recombinant Protein
  • AKR7A2 (Human) Recombinant Protein

AKR7A2 (Human) Recombinant Protein

Ref: AB-P3498
AKR7A2 (Human) Recombinant Protein

Información del producto

Human AKR7A2 (NP_003680, 1 a.a. - 359 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name AKR7A2
Gene Alias AFAR|AFAR1|AFB1-AR1|AKR7
Gene Description aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLR
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 20% glycerol).
Gene ID 8574

Enviar uma mensagem


AKR7A2 (Human) Recombinant Protein

AKR7A2 (Human) Recombinant Protein