AB-P3492
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 100 ug |
Gene Name | DHFR |
Gene Alias | - |
Gene Description | dihydrofolate reductase |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1 mg/mL |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND |
Form | Liquid |
Antigen species Target species | Human |
Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
Storage Buffer | In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (2 mM DTT, 30% glycerol). |
Gene ID | 1719 |