ALDH2 (Human) Recombinant Protein View larger

Human ALDH2 (NP_000681, 18 a.a. - 517 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P3479

New product

ALDH2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name ALDH2
Gene Alias ALDH-E2|ALDHI|ALDM|MGC1806
Gene Description aldehyde dehydrogenase 2 family (mitochondrial)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQ
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 1 mM EDTA, pH 7.5 (1 mM DTT, 10% glycerol).
Gene ID 217

More info

Human ALDH2 (NP_000681, 18 a.a. - 517 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human ALDH2 (NP_000681, 18 a.a. - 517 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human ALDH2 (NP_000681, 18 a.a. - 517 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.