IL4 (Human) Recombinant Protein View larger

Human IL4 (NP000580, 25 a.a. - 153 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P3477

New product

IL4 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 50 ug
Gene Name IL4
Gene Alias BCGF-1|BCGF1|BSF1|IL-4|MGC79402
Gene Description interleukin 4
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Gene ID 3565

More info

Human IL4 (NP000580, 25 a.a. - 153 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human IL4 (NP000580, 25 a.a. - 153 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human IL4 (NP000580, 25 a.a. - 153 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.