PPIF (Human) Recombinant Protein View larger

Human PPIF (NP_005720, 30 a.a. - 207 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P3472

New product

PPIF (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name PPIF
Gene Alias CYP3|Cyp-D|FLJ90798|MGC117207
Gene Description peptidylprolyl isomerase F
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHCSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris, pH 7.5 (1 mM DTT, 10% glycerol).
Gene ID 10105

More info

Human PPIF (NP_005720, 30 a.a. - 207 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human PPIF (NP_005720, 30 a.a. - 207 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human PPIF (NP_005720, 30 a.a. - 207 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.