Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
IL3 (Human) Recombinant Protein
Abnova
IL3 (Human) Recombinant Protein
Ref: AB-P3461
IL3 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human IL3 (AAC08706, 20 aa. - 152 a.a.) partial recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
IL3
Gene Alias
IL-3|MCGF|MGC79398|MGC79399|MULTI-CSF
Gene Description
interleukin 3 (colony-stimulating factor, multiple)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Form
Liquid
Antigen species Target species
Human
Quality control testing
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer
In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 0.2 mM PMSF).
Gene ID
3562
Enviar uma mensagem
IL3 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*