PPIA (Human) Recombinant Protein
  • PPIA (Human) Recombinant Protein

PPIA (Human) Recombinant Protein

Ref: AB-P3460
PPIA (Human) Recombinant Protein

Información del producto

Human PPIA (NP_066953, 1 a.a. - 165 a.a.) full-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PPIA
Gene Alias CYPA|CYPH|MGC117158|MGC12404|MGC23397
Gene Description peptidylprolyl isomerase A (cyclophilin A)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris, 20 mM NaCl, pH 8.0 (0.5 mM DTT, 10% glycerol).
Gene ID 5478

Enviar uma mensagem


PPIA (Human) Recombinant Protein

PPIA (Human) Recombinant Protein