View larger
Human HK1 (NP_000179, 1 a.a. - 917 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P3458
New product
HK1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | HK1 |
| Gene Alias | HK1-ta|HK1-tb|HK1-tc|HKI|HXK1 |
| Gene Description | hexokinase 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTN |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 12% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl, pH 8.0 (10% glycerol). |
| Gene ID | 3098 |
More info
Human HK1 (NP_000179, 1 a.a. - 917 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.