ATP5D (Human) Recombinant Protein
  • ATP5D (Human) Recombinant Protein

ATP5D (Human) Recombinant Protein

Ref: AB-P3443
ATP5D (Human) Recombinant Protein

Información del producto

Human ATP5D (NP_001678, 23 a.a. - 168 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name ATP5D
Gene Alias -
Gene Description ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol).
Gene ID 513

Enviar uma mensagem


ATP5D (Human) Recombinant Protein

ATP5D (Human) Recombinant Protein