CDC26 (Human) Recombinant Protein
  • CDC26 (Human) Recombinant Protein

CDC26 (Human) Recombinant Protein

Ref: AB-P3442
CDC26 (Human) Recombinant Protein

Información del producto

Human CDC26 (NP_644815, 1 a.a. - 85 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name CDC26
Gene Alias C9orf17
Gene Description cell division cycle 26 homolog (S. cerevisiae)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (40% glycerol).
Gene ID 246184

Enviar uma mensagem


CDC26 (Human) Recombinant Protein

CDC26 (Human) Recombinant Protein