SULT2A1 (Human) Recombinant Protein
  • SULT2A1 (Human) Recombinant Protein

SULT2A1 (Human) Recombinant Protein

Ref: AB-P3441
SULT2A1 (Human) Recombinant Protein

Información del producto

Human SULT2A1 (NP_003158, 1 a.a. - 285 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name SULT2A1
Gene Alias DHEA-ST|DHEAS|HST|ST2|ST2A3|STD|hSTa
Gene Description sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLS
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 1 mM DTT).
Gene ID 6822

Enviar uma mensagem


SULT2A1 (Human) Recombinant Protein

SULT2A1 (Human) Recombinant Protein