HSPB11 (Human) Recombinant Protein
  • HSPB11 (Human) Recombinant Protein

HSPB11 (Human) Recombinant Protein

Ref: AB-P3438
HSPB11 (Human) Recombinant Protein

Información del producto

Human HSPB11 (NP_057210, 1 a.a. - 144 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name HSPB11
Gene Alias C1orf41|HSPCO34|PP25
Gene Description heat shock protein family B (small), member 11
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (10% glycerol, 2 mM DTT).
Gene ID 51668

Enviar uma mensagem


HSPB11 (Human) Recombinant Protein

HSPB11 (Human) Recombinant Protein