Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CUTA (Human) Recombinant Protein
Abnova
CUTA (Human) Recombinant Protein
Ref: AB-P3404
CUTA (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CUTA (NP_001014840, 33 a.a. - 179 a.a.) partial recombinant protein with His tag at C-terminal expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
CUTA
Gene Alias
ACHAP|C6orf82|MGC111154
Gene Description
cutA divalent cation tolerance homolog (E. coli)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
SDS-PAGE
Immunogen Prot. Seq
MRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
Form
Liquid
Antigen species Target species
Human
Quality control testing
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer
In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID
51596
Enviar uma mensagem
CUTA (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*