View larger
Human BMP4 (NP_001193, 293 a.a. - 408 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3398
New product
BMP4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | BMP4 |
| Gene Alias | BMP2B|BMP2B1|MCOPS6|ZYME |
| Gene Description | bone morphogenetic protein 4 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 3 ug by 15% SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 10 mM Sodium citrate buffer, pH 3.5 (10% glycerol). |
| Gene ID | 652 |
More info
Human BMP4 (NP_001193, 293 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.