BMP4 (Human) Recombinant Protein
  • BMP4 (Human) Recombinant Protein

BMP4 (Human) Recombinant Protein

Ref: AB-P3398
BMP4 (Human) Recombinant Protein

Información del producto

Human BMP4 (NP_001193, 293 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name BMP4
Gene Alias BMP2B|BMP2B1|MCOPS6|ZYME
Gene Description bone morphogenetic protein 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug by 15% SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 10 mM Sodium citrate buffer, pH 3.5 (10% glycerol).
Gene ID 652

Enviar uma mensagem


BMP4 (Human) Recombinant Protein

BMP4 (Human) Recombinant Protein