AB-P3391
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 100 ug |
Gene Name | HSPA1A |
Gene Alias | FLJ54303|FLJ54370|FLJ54392|FLJ54408|FLJ75127|HSP70-1|HSP70-1A|HSP70I|HSP72|HSPA1|HSPA1B |
Gene Description | heat shock 70kDa protein 1A |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1 mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDN |
Form | Liquid |
Antigen species Target species | Human |
Quality control testing | 3 ug by 15% SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
Storage Buffer | In 20 mM Tris-HCl buffer, pH 7.5, (2 mM DTT). |
Gene ID | 3303 |