HSPA1A (Human) Recombinant Protein
  • HSPA1A (Human) Recombinant Protein

HSPA1A (Human) Recombinant Protein

Ref: AB-P3391
HSPA1A (Human) Recombinant Protein

Información del producto

Human HSPA1A (NP_005336, 1 a.a. - 641 a.a.) full-length recombinant protein with His tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name HSPA1A
Gene Alias FLJ54303|FLJ54370|FLJ54392|FLJ54408|FLJ75127|HSP70-1|HSP70-1A|HSP70I|HSP72|HSPA1|HSPA1B
Gene Description heat shock 70kDa protein 1A
Storage Conditions Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDN
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug by 15% SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20 mM Tris-HCl buffer, pH 7.5, (2 mM DTT).
Gene ID 3303

Enviar uma mensagem


HSPA1A (Human) Recombinant Protein

HSPA1A (Human) Recombinant Protein