HIST2H3A (Human) Recombinant Protein (P01)
  • HIST2H3A (Human) Recombinant Protein (P01)

HIST2H3A (Human) Recombinant Protein (P01)

Ref: AB-H00333932-P01
HIST2H3A (Human) Recombinant Protein (P01)

Información del producto

Human HIST2H3A full-length ORF ( NP_001005464.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name HIST2H3A
Gene Alias H3/n|H3/o
Gene Description histone cluster 2, H3a
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 333932

Enviar uma mensagem


HIST2H3A (Human) Recombinant Protein (P01)

HIST2H3A (Human) Recombinant Protein (P01)