TAAR6 (Human) Recombinant Protein
  • TAAR6 (Human) Recombinant Protein

TAAR6 (Human) Recombinant Protein

Ref: AB-H00319100-G01
TAAR6 (Human) Recombinant Protein

Información del producto

Human TAAR6 full-length ORF (NP_778237.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name TAAR6
Gene Alias RP11-295F4.3|SCZD5|TA4|TRAR4
Gene Description trace amine associated receptor 6
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERK
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 319100

Enviar uma mensagem


TAAR6 (Human) Recombinant Protein

TAAR6 (Human) Recombinant Protein