OR2L13 (Human) Recombinant Protein
  • OR2L13 (Human) Recombinant Protein

OR2L13 (Human) Recombinant Protein

Ref: AB-H00284521-G01
OR2L13 (Human) Recombinant Protein

Información del producto

Human OR2L13 full-length ORF (NP_787107.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name OR2L13
Gene Alias MGC40047|OR2L14
Gene Description olfactory receptor, family 2, subfamily L, member 13
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYFLLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYDRYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDVPAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTISTHLTVVIFYYAPFV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 284521

Enviar uma mensagem


OR2L13 (Human) Recombinant Protein

OR2L13 (Human) Recombinant Protein