Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
NCR3 (Human) Recombinant Protein
Abnova
NCR3 (Human) Recombinant Protein
Ref: AB-H00259197-H01
NCR3 (Human) Recombinant Protein
Contacte-nos
Información del producto
Purified NCR3 (NP_667341.1 19 a.a. - 135 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size
25 ug
Gene Name
NCR3
Gene Alias
1C7|CD337|LY117|MALS|NKp30
Gene Description
natural cytotoxicity triggering receptor 3
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration
&ge
Application Key
WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Form
Liquid
Antigen species Target species
Human
Quality control testing
SDS-PAGE and Western Blot
Storage Buffer
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host
Human HEK293T cells
Gene ID
259197
Enviar uma mensagem
NCR3 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*