Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
OPN5 (Human) Recombinant Protein
Abnova
OPN5 (Human) Recombinant Protein
Ref: AB-H00221391-G01
OPN5 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human OPN5 full-length ORF (ADR82953.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size
2 ug
Gene Name
OPN5
Gene Alias
NEUROPSIN|PGR12|TMEM13
Gene Description
opsin 5
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
AP
Immunogen Prot. Seq
MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVAM
Form
Liquid
Recomended Dilution
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species
Human
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID
221391
Enviar uma mensagem
OPN5 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*