SLC5A10 (Human) Recombinant Protein
  • SLC5A10 (Human) Recombinant Protein

SLC5A10 (Human) Recombinant Protein

Ref: AB-H00125206-G01
SLC5A10 (Human) Recombinant Protein

Información del producto

Human SLC5A10 full-length ORF (ADZ15561.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name SLC5A10
Gene Alias FLJ25217|SGLT5
Gene Description solute carrier family 5 (sodium/glucose cotransporter), member 10
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTWWPIGASLFASSEGSGLFIGLAGSGAAGGLAVAGFEWNATYVLLALAWVFVPIYISSEIVTLPEYIQKRYGGQRIRMYLSVLSLLLSVFTKISLDLYAGALFVHICLGWNFYLSTILTLGITALYTIAAFDQIGGYGQLEAAYAQAIPSRTIANTTCHLPRTDAMHMFRDPHTGDLPWTGMTFGLTIMATWYWCTDQVIVQRSLSARDLNHAKAGSILASYLKMLPMGLIIMPGMISRALFPGAHVYEERHQV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 125206

Enviar uma mensagem


SLC5A10 (Human) Recombinant Protein

SLC5A10 (Human) Recombinant Protein