B3GNT7 (Human) Recombinant Protein (P01)
  • B3GNT7 (Human) Recombinant Protein (P01)

B3GNT7 (Human) Recombinant Protein (P01)

Ref: AB-H00093010-P01
B3GNT7 (Human) Recombinant Protein (P01)

Información del producto

Human B3GNT7 full-length ORF ( AAI48681.1, 1 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name B3GNT7
Gene Alias beta3GnT7
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYGDILQWGFLDTFFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 93010

Enviar uma mensagem


B3GNT7 (Human) Recombinant Protein (P01)

B3GNT7 (Human) Recombinant Protein (P01)