Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
TAAR8 (Human) Recombinant Protein
Abnova
TAAR8 (Human) Recombinant Protein
Ref: AB-H00083551-G01
TAAR8 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human TAAR8 full-length ORF (NP_444508.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size
2 ug
Gene Name
TAAR8
Gene Alias
GPR102|TA5|TAR5|TRAR5
Gene Description
trace amine associated receptor 8
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
AP
Immunogen Prot. Seq
MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFKQLHSPTNFLIASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELVSALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESSSESYKIRVAKRERKA
Form
Liquid
Recomended Dilution
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species
Human
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID
83551
Enviar uma mensagem
TAAR8 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*