ADAMTS12 (Human) Recombinant Protein (P01)
  • ADAMTS12 (Human) Recombinant Protein (P01)

ADAMTS12 (Human) Recombinant Protein (P01)

Ref: AB-H00081792-P01
ADAMTS12 (Human) Recombinant Protein (P01)

Información del producto

Human ADAMTS12 full-length ORF ( AAH58841.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name ADAMTS12
Gene Alias PRO4389
Gene Description ADAM metallopeptidase with thrombospondin type 1 motif, 12
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFW
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 81792

Enviar uma mensagem


ADAMTS12 (Human) Recombinant Protein (P01)

ADAMTS12 (Human) Recombinant Protein (P01)