Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CD276 (Human) Recombinant Protein
Abnova
CD276 (Human) Recombinant Protein
Ref: AB-H00080381-H04
CD276 (Human) Recombinant Protein
Contacte-nos
Información del producto
Purified CD276 (AAH62581.1 237 a.a. - 461 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size
25 ug
Gene Name
CD276
Gene Alias
B7-H3|B7H3
Gene Description
CD276 molecule
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration
&ge
Application Key
WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq
ITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT
Form
Liquid
Antigen species Target species
Human
Quality control testing
SDS-PAGE and Western Blot
Storage Buffer
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host
Human HEK293T cells
Gene ID
80381
Enviar uma mensagem
CD276 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*