Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
PDCD1LG2 (Human) Recombinant Protein
Abnova
PDCD1LG2 (Human) Recombinant Protein
Ref: AB-H00080380-H02
PDCD1LG2 (Human) Recombinant Protein
Contacte-nos
Información del producto
Purified PDCD1LG2 (AAH74766.1 19 a.a. - 121 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size
25 ug
Gene Name
PDCD1LG2
Gene Alias
B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2
Gene Description
programmed cell death 1 ligand 2
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration
&ge
Application Key
WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq
ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKA
Form
Liquid
Antigen species Target species
Human
Quality control testing
SDS-PAGE and Western Blot
Storage Buffer
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host
Human HEK293T cells
Gene ID
80380
Enviar uma mensagem
PDCD1LG2 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*