ELTD1 (Human) Recombinant Protein
  • ELTD1 (Human) Recombinant Protein

ELTD1 (Human) Recombinant Protein

Ref: AB-H00064123-G01
ELTD1 (Human) Recombinant Protein

Información del producto

Human ELTD1 full-length ORF (AAH25721.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ELTD1
Gene Alias ETL|KPG_003
Gene Description EGF, latrophilin and seven transmembrane domain containing 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTISAKDTLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSFQKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPKRKAAYDSNGNVAVAFLYYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 64123

Enviar uma mensagem


ELTD1 (Human) Recombinant Protein

ELTD1 (Human) Recombinant Protein