SIRPG (Human) Recombinant Protein
  • SIRPG (Human) Recombinant Protein

SIRPG (Human) Recombinant Protein

Ref: AB-H00055423-G01
SIRPG (Human) Recombinant Protein

Información del producto

Human SIRPG full-length ORF (NP_061026.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name SIRPG
Gene Alias CD172g|SIRP-B2|SIRPB2|SIRPgamma|bA77C3.1
Gene Description signal-regulatory protein gamma
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLE
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 55423

Enviar uma mensagem


SIRPG (Human) Recombinant Protein

SIRPG (Human) Recombinant Protein