TAS2R5 (Human) Recombinant Protein
  • TAS2R5 (Human) Recombinant Protein

TAS2R5 (Human) Recombinant Protein

Ref: AB-H00054429-G01
TAS2R5 (Human) Recombinant Protein

Información del producto

Human TAS2R5 full-length ORF (AAH95522.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name TAS2R5
Gene Alias MGC126635|MGC126637|T2R5
Gene Description taste receptor, type 2, member 5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLSAGLGLLMLVAVVEFLIGLIGNGSLVVWSFREWIRKFNWSSYNLIILGLAGCRFLLQWLIILDLSLFPLFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQRAYNLSLWCLLGYFIINLLLTVQIGLTFYHPPQGNSSIRYPFESWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVRAKAHITALKSLGCFLLLHLVYIMASPFSITSKTYPPDLTSVF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 54429

Enviar uma mensagem


TAS2R5 (Human) Recombinant Protein

TAS2R5 (Human) Recombinant Protein