TAS2R9 (Human) Recombinant Protein
  • TAS2R9 (Human) Recombinant Protein

TAS2R9 (Human) Recombinant Protein

Ref: AB-H00050835-G01
TAS2R9 (Human) Recombinant Protein

Información del producto

Human TAS2R9 full-length ORF (NP_076406.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name TAS2R9
Gene Alias T2R9|TRB6
Gene Description taste receptor, type 2, member 9
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLCVISLDGFFMLLFPGTYGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFFWLKLKINKVMLAILLGSFLISLIISVPKNDDMWYHLFKVSHEENITWKFKVSKIPGTFKQLTLNLGVMVPFILCLISFFLLLFSLVRHTKQIRLHATGFRDPSTEAHMRAIKAVIIFLLLLIVYYPVFLVMTSSA
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 50835

Enviar uma mensagem


TAS2R9 (Human) Recombinant Protein

TAS2R9 (Human) Recombinant Protein