View larger
Purified LAMP3 (AAH32940.1 28 a.a. - 381 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in hu
AB-H00027074-H01
New product
LAMP3 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | LAMP3 |
| Gene Alias | CD208|DC-LAMP|DCLAMP|LAMP|TSC403 |
| Gene Description | lysosomal-associated membrane protein 3 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Concentration | &ge |
| Application Key | WB,ELISA,SDS-PAGE,PI |
| Immunogen Prot. Seq | KAFPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLL |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE and Western Blot |
| Storage Buffer | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Host | Human HEK293T cells |
| Gene ID | 27074 |
More info
Purified LAMP3 (AAH32940.1 28 a.a. - 381 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.