SIGLEC7 (Human) Recombinant Protein
  • SIGLEC7 (Human) Recombinant Protein

SIGLEC7 (Human) Recombinant Protein

Ref: AB-H00027036-G01
SIGLEC7 (Human) Recombinant Protein

Información del producto

Human SIGLEC7 full-length ORF (NP_055200.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name SIGLEC7
Gene Alias AIRM1|CD328|CDw328|D-siglec|QA79|SIGLEC-7|p75|p75/AIRM1
Gene Description sialic acid binding Ig-like lectin 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTAS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 27036

Enviar uma mensagem


SIGLEC7 (Human) Recombinant Protein

SIGLEC7 (Human) Recombinant Protein