NTSR2 (Human) Recombinant Protein
  • NTSR2 (Human) Recombinant Protein

NTSR2 (Human) Recombinant Protein

Ref: AB-H00023620-G01
NTSR2 (Human) Recombinant Protein

Información del producto

Human NTSR2 full-length ORF (AAH37776.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name NTSR2
Gene Alias NTR2
Gene Description neurotensin receptor 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSVHVVLKARAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCLAVCQPLCARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 23620

Enviar uma mensagem


NTSR2 (Human) Recombinant Protein

NTSR2 (Human) Recombinant Protein