TNFRSF13B (Human) Recombinant Protein
  • TNFRSF13B (Human) Recombinant Protein

TNFRSF13B (Human) Recombinant Protein

Ref: AB-H00023495-H01
TNFRSF13B (Human) Recombinant Protein

Información del producto

Purified TNFRSF13B (NP_036584.1 2 a.a. - 165 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 2 ug
Gene Name TNFRSF13B
Gene Alias CD267|CVID|FLJ39942|MGC133214|MGC39952|TACI|TNFRSF14B
Gene Description tumor necrosis factor receptor superfamily, member 13B
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 23495

Enviar uma mensagem


TNFRSF13B (Human) Recombinant Protein

TNFRSF13B (Human) Recombinant Protein