Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
AFG3L2 (Human) Recombinant Protein (P01)
Abnova
AFG3L2 (Human) Recombinant Protein (P01)
Ref: AB-H00010939-P01
AFG3L2 (Human) Recombinant Protein (P01)
Contacte-nos
Información del producto
Human AFG3L2 full-length ORF ( AAH65016.1, 1 a.a. - 797 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size
2 ug
Gene Name
AFG3L2
Gene Alias
FLJ25993
Gene Description
AFG3 ATPase family gene 3-like 2 (yeast)
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA,WB-Re,AP,Array
Immunogen Prot. Seq
MAHRCLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVTTQARASRNSLLTDIIAAYQRFCSRPPKGFEKYFPNGKNGKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGGKKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTFTPGKTPVDGQYVWFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDGSFLL
Antigen species Target species
Human
Quality control testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID
10939
Enviar uma mensagem
AFG3L2 (Human) Recombinant Protein (P01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*