CALCRL (Human) Recombinant Protein
  • CALCRL (Human) Recombinant Protein

CALCRL (Human) Recombinant Protein

Ref: AB-H00010203-G01
CALCRL (Human) Recombinant Protein

Información del producto

Human CALCRL full-length ORF (NP_005786.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CALCRL
Gene Alias CGRPR|CRLR
Gene Description calcitonin receptor-like
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEKKCTLYFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 10203

Enviar uma mensagem


CALCRL (Human) Recombinant Protein

CALCRL (Human) Recombinant Protein