TNFSF15 (Human) Recombinant Protein
  • TNFSF15 (Human) Recombinant Protein

TNFSF15 (Human) Recombinant Protein

Ref: AB-H00009966-H01
TNFSF15 (Human) Recombinant Protein

Información del producto

Purified TNFSF15 (AAH74941.1, 72 a.a. - 251 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name TNFSF15
Gene Alias MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A
Gene Description tumor necrosis factor (ligand) superfamily, member 15
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 9966

Enviar uma mensagem


TNFSF15 (Human) Recombinant Protein

TNFSF15 (Human) Recombinant Protein