RNF10 (Human) Recombinant Protein (P01)
  • RNF10 (Human) Recombinant Protein (P01)

RNF10 (Human) Recombinant Protein (P01)

Ref: AB-H00009921-P01
RNF10 (Human) Recombinant Protein (P01)

Información del producto

Human RNF10 full-length ORF ( AAH16622, 1 a.a. - 811 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name RNF10
Gene Alias KIAA0262|MGC126758|MGC126764|RIE2
Gene Description ring finger protein 10
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MPLSSPNAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSSGSKRYNRKRELSYPKNESFNNQSRRSSSQKSKTFNKMPPQRGGGSSKLFSSSFNGGRRDEVAEAQRAEFSPAQFSGPKKINLNHLLNFTFEPRGQTGHFEGSGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 9921

Enviar uma mensagem


RNF10 (Human) Recombinant Protein (P01)

RNF10 (Human) Recombinant Protein (P01)