GPR50 (Human) Recombinant Protein
  • GPR50 (Human) Recombinant Protein

GPR50 (Human) Recombinant Protein

Ref: AB-H00009248-G01
GPR50 (Human) Recombinant Protein

Información del producto

Human GPR50 full-length ORF (AAI03697.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GPR50
Gene Alias H9|MGC125342|Mel1c
Gene Description G protein-coupled receptor 50
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLRNSGNIFVVSLSVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIVAIAINRYCYICHSLQYERIFSVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIFNYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAARDPAGQNPDNQLAEVRNFLTMFVIFLLFAVCWCPINV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 9248

Enviar uma mensagem


GPR50 (Human) Recombinant Protein

GPR50 (Human) Recombinant Protein