SLC16A3 (Human) Recombinant Protein
  • SLC16A3 (Human) Recombinant Protein

SLC16A3 (Human) Recombinant Protein

Ref: AB-H00009123-G01
SLC16A3 (Human) Recombinant Protein

Información del producto

Human SLC16A3 full-length ORF (ADR83188.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name SLC16A3
Gene Alias MCT3|MCT4|MGC138472|MGC138474
Gene Description solute carrier family 16, member 3 (monocarboxylic acid transporter 4)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGVITGLGLALNFQPSLIMLNRYFSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGFLILGGLLLNCCVCAALMRPLVVTAQPGSGPPRPSRRLLDLSVFRDRGFVLYAVAASVMVLGLFVPPVFVVSYAKD
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 9123

Enviar uma mensagem


SLC16A3 (Human) Recombinant Protein

SLC16A3 (Human) Recombinant Protein