TNFRSF10B (Human) Recombinant Protein View larger

Purified TNFRSF10B (AAH01281.1 56 a.a. - 180 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed i

AB-H00008795-H02

New product

TNFRSF10B (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 2 ug
Gene Name TNFRSF10B
Gene Alias CD262|DR5|KILLER|KILLER/DR5|TRAIL-R2|TRAILR2|TRICK2|TRICK2A|TRICK2B|TRICKB|ZTNFR9
Gene Description tumor necrosis factor receptor superfamily, member 10b
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 8795

More info

Purified TNFRSF10B (AAH01281.1 56 a.a. - 180 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Enviar uma mensagem

Purified TNFRSF10B (AAH01281.1 56 a.a. - 180 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed i

Purified TNFRSF10B (AAH01281.1 56 a.a. - 180 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed i