TNFRSF10D (Human) Recombinant Protein
  • TNFRSF10D (Human) Recombinant Protein

TNFRSF10D (Human) Recombinant Protein

Ref: AB-H00008793-H03
TNFRSF10D (Human) Recombinant Protein

Información del producto

Purified TNFRSF10D (AAH52270.1 56 a.a. - 187 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name TNFRSF10D
Gene Alias CD264|DCR2|TRAILR4|TRUNDD
Gene Description tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAAS
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 8793

Enviar uma mensagem


TNFRSF10D (Human) Recombinant Protein

TNFRSF10D (Human) Recombinant Protein