VIPR2 (Human) Recombinant Protein
  • VIPR2 (Human) Recombinant Protein

VIPR2 (Human) Recombinant Protein

Ref: AB-H00007434-G01
VIPR2 (Human) Recombinant Protein

Información del producto

Human VIPR2 full-length ORF (NP_003373.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name VIPR2
Gene Alias FLJ16511|VPAC2|VPCAP2R
Gene Description vasoactive intestinal peptide receptor 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVC
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 7434

Enviar uma mensagem


VIPR2 (Human) Recombinant Protein

VIPR2 (Human) Recombinant Protein