View larger
Human TNFSF4 full-length ORF (NP_003317.1) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).
AB-H00007292-G01
New product
TNFSF4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | TNFSF4 |
| Gene Alias | CD134L|CD252|GP34|OX-40L|OX4OL|TXGP1 |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 4 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | AP |
| Immunogen Prot. Seq | MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
| Form | Liquid |
| Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Antigen species Target species | Human |
| Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene ID | 7292 |
More info
Human TNFSF4 full-length ORF (NP_003317.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
This product is belong to Proteoliposome (PL).