TNFRSF1B (Human) Recombinant Protein
  • TNFRSF1B (Human) Recombinant Protein

TNFRSF1B (Human) Recombinant Protein

Ref: AB-H00007133-G01
TNFRSF1B (Human) Recombinant Protein

Información del producto

Human TNFRSF1B full-length ORF (NP_001057.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name TNFRSF1B
Gene Alias CD120b|TBPII|TNF-R-II|TNF-R75|TNFBR|TNFR1B|TNFR2|TNFR80|p75|p75TNFR
Gene Description tumor necrosis factor receptor superfamily, member 1B
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGST
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 7133

Enviar uma mensagem


TNFRSF1B (Human) Recombinant Protein

TNFRSF1B (Human) Recombinant Protein